Product Usage: This PRODUCT, exclusively offered by Qualitide, is for RESEARCH USE ONLY. It is intended for in vitro testing and laboratory experimentation. All information on this website serves educational purposes only. Introducing this product into humans or animals is illegal. It must be managed by licensed professionals only. This is not a drug, food, or cosmetic and should not be branded or misused as such.
Description
xCOG449/OP449: Overview and Information
COG449 was originally developed by Cognosci, Inc., later by Oncotide Pharmaceuticals, and therefor name OP449.
How It Works
COG449/OP449 is a cell-penetrating peptide designed to interrupting intracellular protein-protein interaction associated with tumor growth. It inhibits the SET oncoprotein, which is known to impede the tumor suppressor protein phosphatase 2A (PP2A). PP2A plays a critical role in regulating various cellular pathways that can become activated in certain conditions. By inhibiting SET, COG449 may facilitate the activation of PP2A, potentially influencing cellular signaling pathways.
Research Applications
While research studies have investigated the properties of COG449, it is important to note that:
- COG449 has been evaluated in preclinical models regarding its potential effects on tumor growth in various cancers, including leukemia, Burkitt's lymphoma, and oral squamous cell carcinoma.
- This peptide has been studied for its possible use in conjunction with other agents, such as tyrosine kinase inhibitors, to explore potential enhancement of their effects and address challenges like drug resistance in specific contexts.
Chemical Information
- Sequence: (RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)2
-
Molecular Formula:
C404H694N142O76S4
- Molecular Weight: 9223 g/mol
- CAS #: Not available
Important Considerations
This summary is intended for informational purposes only and does not claim to treat, cure, or prevent any diseases or health conditions. COG449 has not received government approval for therapeutic use, and any specific applications should be consulted with healthcare professionals or through appropriate research channels.
Shipping & Return
xReturns Policy
At Qualitide, we are committed to ensuring your satisfaction with our products. Our Satisfaction Guarantee policy allows you to return or exchange any item within 14 days of receiving your order if you are not completely satisfied. Return/Exchange Eligibility To be eligible for a return or exchange: The item must be in its original condition as received, unworn or unused, with tags attached, and in its original packaging. You must provide the receipt or proof of purchase..
If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.
Shipping
At QUALITIDE, we aim to make your shopping experience simple and smooth. Here’s how we handle shipping: Processing Time We process all orders within 0 to 1 business day. Orders placed after business hours, on weekends, or on holidays will be processed the next business day. Delivery Time Once processed, delivery takes 2 to 3 business days, depending on your location and the shipping carrier. Total Delivery Time From placing your order to receiving it, the total time is 2 to 4 business days, including both processing and shipping.
Disclaimer
xAll articles and product information provided on this website are for informational and educational purposes only. The products offered on Qualitides are intended solely for in-vitro research purposes. In-vitro studies ("in glass" studies) are conducted outside of the body. These products are not medicines or drugs and have not been evaluated or approved by the FDA to prevent, treat, diagnose, or cure any medical condition, ailment, or disease. Any form of bodily introduction or administration of these products into humans or animals is strictly prohibited by law. By using this website, you acknowledge and agree to comply with all applicable regulations and restrictions related to the products provided by Qualitides.
- Choosing a selection results in a full page refresh.