Free Shipping on Orders Over $200 🚚✨
Sign up to receive 10% off for your first order
Product Usage: This product is intended as a research chemical only. This designation permits the use of research chemicals strictly for in vitro testing and laboratory research, but not for human or animal.. This product should only be handled by licensed, qualified professionals. All information available on this website is for educational purposes only. This product is not a drug, food, or cosmetic and may not be misbranded, misused, or mislabeled as such. Acknowledged to the Terms and Conditions, the customer hereby agrees to take full responsibility on how to use the product.
LL-37, also known as Human Cathelicidin Antimicrobial Peptide (CAMP), is touted as a “mammal’s core tool” to fight off various harmful microorganisms in the body. It’s produced by many cell types including natural killer (NK) cells, white blood cells, and skin cells. In addition, different body systems such as the respiratory system, gastrointestinal tract, testes, and ocular surface also produce LL-37. This powerful peptide has piqued the interest of the research community because its immune-modulating activities have the potential to accelerate tissue recovery and significantly improve the survival rate of patients with chronic debilitating medical conditions.
LL-37, a human antimicrobial peptide, is composed of 37 amino acids, hence the designation “LL-37.” The sequence of LL-37 is [LL-37, 37 aa], a structure that plays a crucial role in its biological functions. The amphipathic nature of LL-37, with both hydrophilic and hydrophobic regions, allows it to interact with and disrupt microbial membranes, thereby exerting its potent antimicrobial effects.
The sequence of LL-37 is not only essential for its antimicrobial properties but also for its role in modulating the immune system. Specific amino acid residues within the sequence are responsible for binding to and neutralizing lipopolysaccharides (LPS), which are components of the outer membrane of Gram-negative bacteria. By neutralizing LPS, LL-37 helps to prevent excessive inflammatory responses, thus protecting the host from potential damage due to overactive immune reactions.
Furthermore, the sequence of LL-37 is involved in signaling pathways that promote wound healing and tissue regeneration. For instance, certain segments of the peptide can interact with cell surface receptors, triggering pathways that lead to increased cell proliferation and migration. This makes LL-37 a valuable component not only in the innate immune response but also in the processes of healing and tissue repair.
CAS. #: 154947-66-7
Formula:
C205H340N50O53
M.W.: 4493.3 g/mol
Synonyms: CAP-18, Cathelicidin, antibacterial peptide LL-37
LL-37 Is a Potent Antimicrobial
LL-37 is part of the innate immune system and as such is one of the first pieces of the immune system to be activated during infection. Research in skin infections suggests that normal skin has very low levels of LL-37 but that the peptide accumulates rapidly in the presence of invading pathogens. The peptide has been shown to work in tandem with other proteins, like human beta-defensin 2 to combat infection.
LL-37 primarily works by binding to bacterial lipopolysaccharide (LPS), a major component of the outer membrane of gram-negative bacteria. LPS is a critical component of membrane integrity in these bacteria.
The ability of LL-37 to bind to and interfere with LPS means it is exceptionally deadly to certain bacteria. There is interest in using the peptide exogenously to treat serious bacterial infections in people.
Despite the fact that LL-37 acts on the cell membrane components of gram-negative bacteria, it still has potent gram-positive effects as well. This could make it a beneficial treatment for staph infections and other serious bacteria. In vitro research indicates that LL-37 enhances the effects of lysozyme, an enzyme responsible for the destruction of gram positive bacteria like Staph aureus
LL-37, while primarily billed as an antimicrobial peptide, actually plays a role in a number of inflammatory diseases such as psoriasis, lupus, rheumatoid arthritis, and atherosclerosis. Depending on the local inflammatory environment and the particular cells involved, LL-37 has several different immune system modulating behaviors. It has been found to:
Interestingly, LL-37 does not affect the immune system in the same way all of the time. Research in cell culture has shown that the inflammatory environment affects how cells of the immune system respond to LL-37. T-cells, for instance, will increase their inflammatory actions in response to LL-37 when they are not activated but decrease inflammatory action when already activated[2]. It appears that LL-37 has potent homeostatic effects, helping to balance the immune response and prevent it from becoming overactive in the setting of infection. These findings would suggest that LL-37 could play a role in helping to regulate the unchecked inflammation of autoimmune diseases. This may explain why there has been a strong correlation between LL-37 levels and autoimmune disease. It was previously thought that LL-37 might be causing autoimmune inflammation, but more recent evidence suggests that high levels of LL-37 in autoimmune disease may actually be preventing more fulminant inflammation.
At Qualitide, we are committed to ensuring your satisfaction with our products. Our Satisfaction Guarantee policy allows you to return or exchange any item within 14 days of receiving your order if you are not completely satisfied. Return/Exchange Eligibility To be eligible for a return or exchange: The item must be in its original condition as received, unworn or unused, with tags attached, and in its original packaging. You must provide the receipt or proof of purchase..
If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.
At QUALITIDE, we aim to make your shopping experience simple and smooth. Here’s how we handle shipping: Processing Time We process all orders within 0 to 1 business day. Orders placed after business hours, on weekends, or on holidays will be processed the next business day. Delivery Time Once processed, delivery takes 2 to 3 business days, depending on your location and the shipping carrier. Total Delivery Time From placing your order to receiving it, the total time is 2 to 4 business days, including both processing and shipping.
All articles and product information provided on this website are for informational and educational purposes only. The products offered on Qualitides are intended solely for in-vitro research purposes. In-vitro studies ("in glass" studies) are conducted outside of the body. These products are not medicines or drugs and have not been evaluated or approved by the FDA to prevent, treat, diagnose, or cure any medical condition, ailment, or disease. Any form of bodily introduction or administration of these products into humans or animals is strictly prohibited by law. By using this website, you acknowledge and agree to comply with all applicable regulations and restrictions related to the products provided by Qualitides.
Get the latest updates on new products and upcoming sales
Thanks for subscribing!
This email has been registered!